PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.7242s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MIKC_MADS
Protein Properties Length: 224aa    MW: 25710.4 Da    PI: 9.7666
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.7242s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.89.3e-31959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krien + rqvtfskRrng+lKKA+ELSvLCdaeva+iifs++gklye+ss
  Cagra.7242s0001.1.p  9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSS 59
                         79***********************************************96 PP

2K-box73.84.9e-2580172799
                K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                          +++ + ++++++ e   L ++ie L+ + R+++Ge+Le  s++eLqqLe+qL++sl kiR++K++ll+e+ie+l++ke++l  enk+L +
  Cagra.7242s0001.1.p  80 NQKRNDNSQQSKDETYGLARKIEHLEISTRKMMGEGLEASSIEELQQLENQLDRSLLKIRARKYQLLREEIEKLKEKERSLIAENKMLME 169
                          4467788999*******************************************************************************9 PP

                K-box  97 kle 99 
                          k e
  Cagra.7242s0001.1.p 170 KCE 172
                          986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.071161IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.1E-32374IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002651.09E-40372No hitNo description
PRINTSPR004044.8E-31323IPR002100Transcription factor, MADS-box
PfamPF003195.4E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-313859IPR002100Transcription factor, MADS-box
PfamPF014869.7E-2583172IPR002487Transcription factor, K-box
PROSITE profilePS5129715.64987177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010082Biological Processregulation of root meristem growth
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:2000012Biological Processregulation of auxin polar transport
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MVRGKTEMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALIIFSP RGKLYEFSSS  60
SSIPKTVERY QKRIQDLGSN QKRNDNSQQS KDETYGLARK IEHLEISTRK MMGEGLEASS  120
IEELQQLENQ LDRSLLKIRA RKYQLLREEI EKLKEKERSL IAENKMLMEK CEKQGRGIIA  180
RTTSSSTASE LDIDNNDEME VVTDLFIGPP PETRHFKKFP PPN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A2e-16360259MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-16360259MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-16360259MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D2e-16360259MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A3e-16360259Myocyte-specific enhancer factor 2A
3kov_B3e-16360259Myocyte-specific enhancer factor 2A
3kov_I3e-16360259Myocyte-specific enhancer factor 2A
3kov_J3e-16360259Myocyte-specific enhancer factor 2A
3mu6_A2e-16360259Myocyte-specific enhancer factor 2A
3mu6_B2e-16360259Myocyte-specific enhancer factor 2A
3mu6_C2e-16360259Myocyte-specific enhancer factor 2A
3mu6_D2e-16360259Myocyte-specific enhancer factor 2A
3p57_A3e-16360259Myocyte-specific enhancer factor 2A
3p57_B3e-16360259Myocyte-specific enhancer factor 2A
3p57_C3e-16360259Myocyte-specific enhancer factor 2A
3p57_D3e-16360259Myocyte-specific enhancer factor 2A
3p57_I3e-16360259Myocyte-specific enhancer factor 2A
3p57_J3e-16360259Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2304640.0AK230464.1 Arabidopsis thaliana mRNA for MADS-box protein AGL14, complete cds, clone: RAFL26-03-G06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006288611.11e-150hypothetical protein CARUB_v10001906mg
SwissprotQ388381e-133AGL14_ARATH; Agamous-like MADS-box protein AGL14
TrEMBLR0GXA61e-150R0GXA6_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.6__3138__AT4G11880.11e-134(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11880.11e-127AGAMOUS-like 14